PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo3G0014300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 497aa    MW: 53918.2 Da    PI: 6.7335
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo3G0014300genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.6e-39109169262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++k l+cprC+s +tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s 
  Spipo3G0014300 109 PDKLLPCPRCNSLDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKHSA 169
                     78999*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-30106166IPR003851Zinc finger, Dof-type
PfamPF027014.8E-32111167IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.901113167IPR003851Zinc finger, Dof-type
PROSITE patternPS013610115151IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MSEARDPAIK LFGRTIPLPE SRSVENSDRS TMDEAGEEVK DSRPDPPTLE RLQGTEPVEL  60
DASSISCSAD ENSDCQSTKQ GDKAASDPKT KQLKNEPDGS NQQKVLKKPD KLLPCPRCNS  120
LDTKFCYYNN YNVNQPRHFC KNCQRYWTAG GTMRNVPVGA GRRKNKHSAS QCRHLLMPSE  180
AAPSPQADHP DSAHNQPLAG SLMGSRTVLK FGADAPLCES IASVLHLGDQ KRNPRMGPPQ  240
CDENGEEPPS SATSLVASGA VENKFPDNSD QMEQGGVQSC SNEPTPLPHL ECFPGQPWPY  300
PWAPGWTGFA LPAGQHPSKP SQEHDNSNGN PASWNSHMMM ASPAFCGPAI RLPLVPASFW  360
GYAPNWPHET SWSTPWIGSG GVLPSPSSSS GGCSGVVSPT LGKHCRDSSL LVEEKTKSLW  420
IPKTLRIDDP DEAAKSSIWA TLGIKPDPDE SMKKSGIFKG FQPSKIEGRD LHLERKQVLH  480
LNPAALSRSQ TFQEST*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ9249214e-31GQ924921.1 Eleusine coracana cultivar VL315 Dof-type zinc finger protein gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008792513.11e-164PREDICTED: cyclic dof factor 2-like
TrEMBLW1NNG21e-147W1NNG2_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.24e-74cycling DOF factor 2